Sign in or Register   Sign in or Register
  |  

Mouse Anti-NFIA Recombinant Antibody (16H11) (CBMAB-BR371LY)

The product is antibody recognizes NFIA. The antibody 16H11 immunoassay techniques such as: FC, IHC-P, WB.
See all NFIA antibodies

Summary

Host Animal
Mouse
Specificity
Human
Clone
16H11
Antibody Isotype
IgG2b
Application
FC: 1-3 μg/1x10 cells, IHC-P: 0.5-1 μg/ml, WB: 0.1-0.5 μg/ml

Basic Information

Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human NFIA (180-224aa AYFVHAADSSQSESPSQPSDADIKDQPENGHLGFQDSFVTSGVFS), different from the related mouse sequence by one amino acid, and identical to the related rat sequence.
Specificity
Human
Antibody Isotype
IgG2b
Clonality
Monoclonal
Application Notes
The COA includes recommended starting dilutions, optimal dilutions should be determined by the end user.

Formulations & Storage [For reference only, actual COA shall prevail!]

Format
Lyophilized
Preservative
0.05 mg sodium azide
Storage
Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freezethaw cycles.

Target

Full Name
nuclear factor I A
Introduction
This gene encodes a member of the NF1 (nuclear factor 1) family of transcription factors. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2011]
Entrez Gene ID
4774
UniProt ID
Q12857
Alternative Names
Nuclear factor 1 A-type; NF1-A; Nuclear factor 1/A; CCAAT-box-binding transcription factor; CTF; Nuclear factor I/A; NF-I/A; NFI-A; TGGCA-binding protein; NFIA; KIAA1439
Function
Recognizes and binds the palindromic sequence 5'-TTGGCNNNNNGCCAA-3' present in viral and cellular promoters and in the origin of replication of adenovirus type 2. These proteins are individually capable of activating transcription and replication.
Biological Process
DNA replicationIEA:UniProtKB-KW
Positive regulation of transcription by RNA polymerase IIManual Assertion Based On ExperimentIDA:NTNU_SB
Regulation of transcription by RNA polymerase IIManual Assertion Based On ExperimentIBA:GO_Central
Regulation of transcription, DNA-templated1 PublicationNAS:UniProtKB
Synapse maturationIEA:Ensembl
Ureter developmentIEA:Ensembl
Viral genome replication1 PublicationNAS:UniProtKB
Cellular Location
Nucleus
Involvement in disease
Brain malformations with or without urinary tract defects (BRMUTD):
A syndrome characterized by corpus callosum hypoplasia or agenesis, hydrocephalus or ventricular enlargement, developmental delay, and urinary tract defects.

Campbell, C. E., Webber, K., Bard, J. E., Chaves, L. D., Osinski, J. M., & Gronostajski, R. M. (2024). Nuclear Factor IA (Nfia) and Nuclear Factor IB (Nfib) are jointly required for mouse postnatal neural stem cell self-renewal. Stem Cells and Development, (ja).

Kaczorowski, M., Matysiak, J., Kielb, P., Malkiewicz, B., & Halon, A. (2022). Nuclear Factor IA Is Down-regulated in Muscle-invasive and High-grade Bladder Cancers. Anticancer Research, 42(1), 493-500.

Takouda, J., Katada, S., Imamura, T., Sanosaka, T., & Nakashima, K. (2021). SoxE group transcription factor Sox8 promotes astrocytic differentiation of neural stem/precursor cells downstream of Nfia. Pharmacology Research & Perspectives, 9(6), e00749.

Yuan, H., Li, M., Feng, X., Zhu, E., & Wang, B. (2021). miR‐142a‐5p promoted osteoblast differentiation via targeting nuclear factor IA. Journal of Cellular Physiology, 236(3), 1810-1821.

Hiraike, Y., Waki, H., Miyake, K., Wada, T., Oguchi, M., Saito, K., ... & Kadowaki, T. (2020). NFIA differentially controls adipogenic and myogenic gene program through distinct pathways to ensure brown and beige adipocyte differentiation. PLoS Genetics, 16(9), e1009044.

Chen, K. S., Bridges, C. R., Lynton, Z., Lim, J. W., Stringer, B. W., Rajagopal, R., ... & Bunt, J. (2020). Transcription factors NFIA and NFIB induce cellular differentiation in high-grade astrocytoma. Journal of Neuro-Oncology, 146, 41-53.

Laug, D., Huang, T. W., Huerta, N. A. B., Huang, A. Y. S., Sardar, D., Ortiz-Guzman, J., ... & Deneen, B. (2019). Nuclear factor IA regulates diverse reactive astrocyte responses after CNS injury. The Journal of Clinical Investigation, 129(10), 4408-4418.

Yu, X., Wang, M., Zuo, J., Wahafu, A., Mao, P., Li, R., ... & Wang, J. (2019). Nuclear factor IA promotes temozolomide resistance in glioblastoma via activation of nuclear factor κB pathway. Life sciences, 236, 116917.

Tchieu, J., Calder, E. L., Guttikonda, S. R., Gutzwiller, E. M., Aromolaran, K. A., Steinbeck, J. A., ... & Studer, L. (2019). NFIA is a gliogenic switch enabling rapid derivation of functional human astrocytes from pluripotent stem cells. Nature biotechnology, 37(3), 267-275.

Sun, C., Li, Y., Tan, Y., Zhang, H., Liang, Y., Zeng, J., ... & Zou, H. (2019). A novel role for NFIA in restoring radiosensitivity in radioresistant NSCLC cells by downregulating the AKT and ERK pathways. Biochemical and biophysical research communications, 515(4), 558-564.

Ask a question We look forward to hearing from you.
0 reviews or Q&As

Purchasing FAQs
Technical FAQs

Loading...
Have you used Mouse Anti-NFIA Recombinant Antibody (16H11)?
Submit a review and get a Coupon or an Amazon gift card. 20% off Coupon $30 eGift Card
Submit a review
Loading...
For research use only. Not intended for any clinical use.

Custom Antibody Labeling

We also offer labeled antibodies developed using our catalog antibody products and nonfluorescent conjugates (HRP, AP, Biotin, etc.) or fluorescent conjugates (Alexa Fluor, FITC, TRITC, Rhodamine, Texas Red, R-PE, APC, Qdot Probes, Pacific Dyes, etc.).

Online Inquiry

Documents

Contact us

  • Tel: (USA)
  • (UK)
  • Fax:
  • Email:

Submit A Review

Go to
Compare