Mouse Anti-PBRM1 Recombinant Antibody (CBYY-1142) (CBMAB-1146-YY)

Go to compare Compare Online Inquiry
Request for COA
Datasheet Target References Q & As Review & reward Protocols Associated Products

Basic Information

Host Animal
Mouse
Clone
CBYY-1142
Application
WB, IHC, IHC-P
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: KMEEYDDVNLLTADFQLLFNNAKSYYKPDSPEYKAACKLWDLYLRTRNEFVQKGEADDEDDDEDGQDNQGTVTEGSSPAYLKEILEQLLEAIVVATNPSGRLISELFQKLPSKVQYPDYYAIIKEPIDLKTIAQRIQNGSYKSIHA
Specificity
Human
Antibody Isotype
IgG1
Clonality
Monoclonal
Application Notes
The COA includes recommended starting dilutions, optimal dilutions should be determined by the end user.

Formulations & Storage [For reference only, actual COA shall prevail!]

Format
Liquid
Storage
Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze/thaw cycles.
More Infomation

Target

Full Name
polybromo 1
Introduction
This locus encodes a subunit of ATP-dependent chromatin-remodeling complexes. The encoded protein has been identified as in integral component of complexes necessary for ligand-dependent transcriptional activation by nuclear hormone receptors. Mutations at this locus have been associated with primary clear cell renal cell carcinoma. [provided by RefSeq, Feb 2012]
Entrez Gene ID
UniProt ID
Alternative Names
Polybromo 1; BRG1-Associated Factor 180; Polybromo-1D; BAF180; PB1; Protein Polybromo-1; HPB1;
Function
Involved in transcriptional activation and repression of select genes by chromatin remodeling (alteration of DNA-nucleosome topology). Required for the stability of the SWI/SNF chromatin remodeling complex SWI/SNF-B (PBAF). Acts as a negative regulator of cell proliferation.
Biological Process
Chromatin remodelingManual Assertion Based On ExperimentTAS:UniProtKB
Mitotic cell cycleManual Assertion Based On ExperimentTAS:UniProtKB
Negative regulation of cell population proliferationManual Assertion Based On ExperimentIMP:UniProtKB
Positive regulation of cell differentiation1 PublicationIC:ComplexPortal
Positive regulation of double-strand break repair1 PublicationIC:ComplexPortal
Positive regulation of myoblast differentiation1 PublicationIC:ComplexPortal
Positive regulation of T cell differentiation1 PublicationIC:ComplexPortal
Regulation of G0 to G1 transition1 PublicationIC:ComplexPortal
Regulation of G1/S transition of mitotic cell cycle1 PublicationIC:ComplexPortal
Regulation of mitotic metaphase/anaphase transition1 PublicationIC:ComplexPortal
Regulation of nucleotide-excision repair1 PublicationIC:ComplexPortal
Regulation of transcription by RNA polymerase II1 PublicationIC:ComplexPortal
Cellular Location
Nucleus
Involvement in disease
Renal cell carcinoma (RCC):
Renal cell carcinoma is a heterogeneous group of sporadic or hereditary carcinoma derived from cells of the proximal renal tubular epithelium. It is subclassified into clear cell renal carcinoma (non-papillary carcinoma), papillary renal cell carcinoma, chromophobe renal cell carcinoma, collecting duct carcinoma with medullary carcinoma of the kidney, and unclassified renal cell carcinoma. Clear cell renal cell carcinoma is the most common subtype.

Yamashita, N., Morimoto, Y., Fushimi, A., Ahmad, R., Bhattacharya, A., Daimon, T., ... & Kufe, D. (2023). MUC1-C dictates PBRM1-mediated chronic induction of interferon signaling, DNA damage resistance, and immunosuppression in triple-negative breast cancer. Molecular Cancer Research, 21(3), 274-289.

Walton, J., Lawson, K., Prinos, P., Finelli, A., Arrowsmith, C., & Ailles, L. (2023). PBRM1, SETD2 and BAP1—the trinity of 3p in clear cell renal cell carcinoma. Nature Reviews Urology, 20(2), 96-115.

Petell, C. J., Burkholder, N. T., Ruiz, P. A., Skela, J., Foreman, J. R., Southwell, L. E., ... & Strahl, B. D. (2023). The bromo-adjacent homology domains of PBRM1 associate with histone tails and contribute to PBAF-mediated gene regulation. Journal of Biological Chemistry, 299(8).

Chabanon, R. M., Morel, D., Eychenne, T., Colmet-Daage, L., Bajrami, I., Dorvault, N., ... & Postel-Vinay, S. (2021). PBRM1 deficiency confers synthetic lethality to DNA repair inhibitors in cancer. Cancer research, 81(11), 2888-2902.

Karki, M., Jangid, R. K., Anish, R., Seervai, R. N., Bertocchio, J. P., Hotta, T., ... & Tripathi, D. N. (2021). A cytoskeletal function for PBRM1 reading methylated microtubules. Science advances, 7(14), eabf2866.

Liu, X. D., Kong, W., Peterson, C. B., McGrail, D. J., Hoang, A., Zhang, X., ... & Jonasch, E. (2020). PBRM1 loss defines a nonimmunogenic tumor phenotype associated with checkpoint inhibitor resistance in renal carcinoma. Nature communications, 11(1), 2135.

Carril-Ajuria, L., Santos, M., Roldán-Romero, J. M., Rodriguez-Antona, C., & de Velasco, G. (2019). Prognostic and predictive value of PBRM1 in clear cell renal cell carcinoma. Cancers, 12(1), 16.

Porter, E. G., Dhiman, A., Chowdhury, B., Carter, B. C., Lin, H., Stewart, J. C., ... & Dykhuizen, E. C. (2019). PBRM1 regulates stress response in epithelial cells. Iscience, 15, 196-210.

Cai, W., Su, L., Liao, L., Liu, Z. Z., Langbein, L., Dulaimi, E., ... & Yang, H. (2019). PBRM1 acts as a p53 lysine-acetylation reader to suppress renal tumor growth. Nature communications, 10(1), 5800.

Braun, D. A., Ishii, Y., Walsh, A. M., Van Allen, E. M., Wu, C. J., Shukla, S. A., & Choueiri, T. K. (2019). Clinical validation of PBRM1 alterations as a marker of immune checkpoint inhibitor response in renal cell carcinoma. JAMA oncology, 5(11), 1631-1633.

Ask a question We look forward to hearing from you.
0 reviews or Q&As
Loading...
Have you used Mouse Anti-PBRM1 Recombinant Antibody (CBYY-1142)?
Submit a review and get a Coupon or an Amazon gift card. 20% off Coupon $30 eGift Card
Submit a review
Loading...
For research use only. Not intended for any clinical use.

Custom Antibody Labeling

We also offer labeled antibodies developed using our catalog antibody products and nonfluorescent conjugates (HRP, AP, Biotin, etc.) or fluorescent conjugates (Alexa Fluor, FITC, TRITC, Rhodamine, Texas Red, R-PE, APC, Qdot Probes, Pacific Dyes, etc.).

Online Inquiry

Contact us

  • Tel: (USA)
  • (UK)
  • Fax:
  • Email:

Submit A Review

online inquiry
Online Inquiry