Mouse Anti-PRKAB2 Recombinant Antibody (CBMAB-BR404LY)

Go to compare Compare Online Inquiry
Request for COA
Datasheet Target Q & As Review & reward Protocols Associated Products

Basic Information

Host Animal
Mouse
Application
FC: 1-3 μg/1x10 cells
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human AMPK beta 2 (56-89aa DKEFVSWQQDLEDSVKPTQQARPTVIRWSEGGKE), different from the related mouse sequence by three amino acids, and from the related rat sequence by two amino acids.
Specificity
Human
Antibody Isotype
IgG2b
Clonality
Monoclonal
Application Notes
The COA includes recommended starting dilutions, optimal dilutions should be determined by the end user.

Formulations & Storage [For reference only, actual COA shall prevail!]

Format
Liquid
Buffer
50% glycerol
Preservative
0.02% sodium azide
Storage
Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freezethaw cycles.
More Infomation

Target

Full Name
protein kinase, AMP-activated, beta 2 non-catalytic subunit
Entrez Gene ID
UniProt ID
Alternative Names
5'-AMP-activated protein kinase subunit beta-2; AMPK subunit beta-2; PRKAB2
Function
Non-catalytic subunit of AMP-activated protein kinase (AMPK), an energy sensor protein kinase that plays a key role in regulating cellular energy metabolism. In response to reduction of intracellular ATP levels, AMPK activates energy-producing pathways and inhibits energy-consuming processes: inhibits protein, carbohydrate and lipid biosynthesis, as well as cell growth and proliferation. AMPK acts via direct phosphorylation of metabolic enzymes, and by longer-term effects via phosphorylation of transcription regulators. Also acts as a regulator of cellular polarity by remodeling the actin cytoskeleton; probably by indirectly activating myosin. Beta non-catalytic subunit acts as a scaffold on which the AMPK complex assembles, via its C-terminus that bridges alpha (PRKAA1 or PRKAA2) and gamma subunits (PRKAG1, PRKAG2 or PRKAG3).
Biological Process
Cellular response to nutrient levelsManual Assertion Based On ExperimentIDA:ComplexPortal
Fatty acid biosynthetic processIEA:UniProtKB-KW
Positive regulation of cold-induced thermogenesisBy SimilarityISS:YuBioLab
Regulation of catalytic activityIEA:InterPro
Signal transductionManual Assertion Based On ExperimentIBA:GO_Central
Cellular Location
cytoplasm
cytosol
nucleoplasm
nucleotide-activated protein kinase complex
nucleus
PTM
Phosphorylated when associated with the catalytic subunit (PRKAA1 or PRKAA2). Phosphorylated by ULK1 and ULK2; leading to negatively regulate AMPK activity and suggesting the existence of a regulatory feedback loop between ULK1, ULK2 and AMPK.
Ask a question We look forward to hearing from you.
0 reviews or Q&As
Loading...
Have you used Mouse Anti-PRKAB2 Recombinant Antibody?
Submit a review and get a Coupon or an Amazon gift card. 20% off Coupon $30 eGift Card
Submit a review
Loading...
For research use only. Not intended for any clinical use.

Custom Antibody Labeling

We also offer labeled antibodies developed using our catalog antibody products and nonfluorescent conjugates (HRP, AP, Biotin, etc.) or fluorescent conjugates (Alexa Fluor, FITC, TRITC, Rhodamine, Texas Red, R-PE, APC, Qdot Probes, Pacific Dyes, etc.).

Online Inquiry

Contact us

  • Tel: (USA)
  • (UK)
  • Fax:
  • Email:

Submit A Review

online inquiry
Online Inquiry
Happy Thanksgiving
Happy Thanksgiving close ad