Sign in or Register   Sign in or Register
  |  

Rat Anti-Tlr9 Recombinant Antibody (CBYJT-3439) (CBMAB-T2760-YJ)

Provided herein is a Rat monoclonal antibody, which binds to Tlr9 (Toll-Like Receptor 9). The antibody can be used for immunoassay techniques, such as WB, FC.
See all Tlr9 antibodies

Summary

Host Animal
Rat
Specificity
Mouse
Clone
CBYJT-3439
Antibody Isotype
IgG2a
Application
WB, FC

Basic Information

Immunogen
Recombinant fragment corresponding to Mouse TLR9 aa 602-860. Sequence: RFLDFSGNGMGRMWDEGGLYLHFFQGLSGLLKLDLSQNNLHILRPQNLDN LPKSLKLLSLRDNYLSFFNWTSLSFLPNLEVLDLAGNQLKALTNGTLPNG TLLQKLDVSSNSIVSVVPAFFALAVELKEVNLSHNILKTVDRSWFGPIVM NLTVLDVRSNPLHCACGAAFVDLLLEVQTKVPGLANGVKCGSPGQLQGRS IFAQDLRLCLDEVLSWDCFGLSLLAVAVGMVVPILHHLCGWDVWYCFHLC LAWLPLLAR
Specificity
Mouse
Antibody Isotype
IgG2a
Clonality
Monoclonal
Application Notes
The COA includes recommended starting dilutions, optimal dilutions should be determined by the end user.

Formulations & Storage [For reference only, actual COA shall prevail!]

Buffer
PBS, pH 7.4
Storage
Store at 4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze/thaw cycles.
Epitope
aa 602-860

Target

Full Name
TLR9 Gene(Protein Coding) Toll Like Receptor 9
Introduction
TLR9 is a key component of innate and adaptive immunity. TLRs (Toll-like receptors) control host immune response against pathogens through recognition of molecular patterns specific to microorganisms. TLR9 is a nucleotide-sensing TLR which is activated by unmethylated cytidine-phosphate-guanosine (CpG) dinucleotides. TLR9 acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response.
Entrez Gene ID
UniProt ID
Alternative Names
toll-like receptor 9
Function
Key component of innate and adaptive immunity. TLRs (Toll-like receptors) control host immune response against pathogens through recognition of molecular patterns specific to microorganisms. TLR9 is a nucleotide-sensing TLR which is activated by unmethylated cytidine-phosphate-guanosine (CpG) dinucleotides. Acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response (PubMed:11564765, PubMed:17932028).
Controls lymphocyte response to Helicobacter infection (By similarity).
Upon CpG stimulation, induces B-cell proliferation, activation, survival and antibody production (PubMed:23857366).
Biological Process
Biological Process activation of innate immune responseSource:Ensembl
Biological Process cellular response to chloroquineSource:Ensembl
Biological Process cellular response to lipopolysaccharideSource:Ensembl
Biological Process cellular response to metal ionSource:Ensembl
Biological Process defense response to bacteriumSource:UniProtKB1 Publication
Biological Process defense response to Gram-negative bacteriumSource:UniProtKB1 Publication
Biological Process defense response to virusSource:GO_Central1 Publication
Biological Process I-kappaB kinase/NF-kappaB signalingSource:GO_Central1 Publication
Biological Process I-kappaB phosphorylationSource:BHF-UCL1 Publication
Biological Process innate immune responseSource:BHF-UCL1 Publication
Biological Process maintenance of gastrointestinal epitheliumSource:BHF-UCL
Biological Process male gonad developmentSource:Ensembl
Biological Process microglial cell activationSource:Ensembl
Biological Process MyD88-dependent toll-like receptor signaling pathwaySource:Ensembl
Biological Process negative regulation of ATPase-coupled calcium transmembrane transporter activitySource:CACAO1 Publication
Biological Process negative regulation of ERK1 and ERK2 cascadeSource:Ensembl
Biological Process negative regulation of interleukin-6 productionSource:BHF-UCL
Biological Process negative regulation of interleukin-8 productionSource:BHF-UCL1 Publication
Biological Process negative regulation of NF-kappaB transcription factor activitySource:BHF-UCL1 Publication
Biological Process negative regulation of toll-like receptor signaling pathwaySource:BHF-UCL1 Publication
Biological Process positive regulation of autophagySource:Ensembl
Biological Process positive regulation of B cell activationSource:UniProtKB1 Publication
Biological Process positive regulation of B cell proliferationSource:UniProtKB1 Publication
Biological Process positive regulation of chemokine productionSource:BHF-UCL1 Publication
Biological Process positive regulation of gene expressionSource:CACAO1 Publication
Biological Process positive regulation of granulocyte macrophage colony-stimulating factor productionSource:CACAO1 Publication
Biological Process positive regulation of I-kappaB kinase/NF-kappaB signalingSource:BHF-UCL1 Publication
Biological Process positive regulation of immunoglobulin productionSource:UniProtKB1 Publication
Biological Process positive regulation of inflammatory responseSource:BHF-UCL1 Publication
Biological Process positive regulation of interferon-alpha productionSource:UniProtKB1 Publication
Biological Process positive regulation of interferon-beta productionSource:UniProtKB1 Publication
Biological Process positive regulation of interferon-gamma productionSource:UniProtKB1 Publication
Biological Process positive regulation of interleukin-10 productionSource:BHF-UCL
Biological Process positive regulation of interleukin-12 productionSource:BHF-UCL
Biological Process positive regulation of interleukin-18 productionSource:BHF-UCL
Biological Process positive regulation of interleukin-6 productionSource:BHF-UCL2 Publications
Biological Process positive regulation of interleukin-8 productionSource:BHF-UCL3 Publications
Biological Process positive regulation of JNK cascadeSource:BHF-UCL1 Publication
Biological Process positive regulation of JUN kinase activitySource:BHF-UCL1 Publication
Biological Process positive regulation of MAPK cascadeSource:UniProtKB1 Publication
Biological Process positive regulation of NF-kappaB transcription factor activitySource:BHF-UCL1 Publication
Biological Process positive regulation of NIK/NF-kappaB signalingSource:BHF-UCL1 Publication
Biological Process positive regulation of nitric-oxide synthase biosynthetic processSource:BHF-UCL
Biological Process positive regulation of toll-like receptor 9 signaling pathwaySource:Ensembl
Biological Process positive regulation of toll-like receptor signaling pathwaySource:BHF-UCL1 Publication
Biological Process positive regulation of transcription by RNA polymerase IISource:BHF-UCL
Biological Process positive regulation of tumor necrosis factor productionSource:BHF-UCL
Biological Process regulation of B cell differentiationSource:UniProtKB1 Publication
Biological Process regulation of dendritic cell cytokine productionSource:Ensembl
Biological Process regulation of toll-like receptor 9 signaling pathwaySource:UniProtKB1 Publication
Biological Process response to molecule of bacterial originSource:BHF-UCL1 Publication
Biological Process toll-like receptor 9 signaling pathwaySource:InterPro
Biological Process toll-like receptor signaling pathwaySource:GO_Central1 Publication
Cellular Location
Endoplasmic reticulum membrane
Endosome
Lysosome
Cytoplasmic vesicle, phagosome
Relocalizes from endoplasmic reticulum to endosome and lysosome upon stimulation with agonist. Exit from the ER requires UNC93B1. Endolysosomal localization is required for proteolytic cleavage and subsequent activation. Intracellular localization of the active receptor may prevent from responding to self nucleic acid.
Topology
Extracellular: 26-818
Helical: 819-839
Cytoplasmic: 840-1032
PTM
Activated by proteolytic cleavage of the flexible loop between repeats LRR14 and LRR15 within the ectodomain. Cleavage requires UNC93B1. Proteolytically processed by first removing the majority of the ectodomain by either asparagine endopeptidase (AEP) or a cathepsin followed by a trimming event that is solely cathepsin mediated and required for optimal receptor signaling.
Ask a question We look forward to hearing from you.
0 reviews or Q&As
Loading...
Have you used Rat Anti-Tlr9 Recombinant Antibody (CBYJT-3439)?
Submit a review and get a Coupon or an Amazon gift card. 20% off Coupon $30 eGift Card
Submit a review
Loading...
For research use only. Not intended for any clinical use.

Custom Antibody Labeling

We also offer labeled antibodies developed using our catalog antibody products and nonfluorescent conjugates (HRP, AP, Biotin, etc.) or fluorescent conjugates (Alexa Fluor, FITC, TRITC, Rhodamine, Texas Red, R-PE, APC, Qdot Probes, Pacific Dyes, etc.).

Online Inquiry

Documents

Contact us

  • Tel: (USA)
  • (UK)
  • Fax:
  • Email:

Submit A Review

Go to
Compare