Mouse Anti-AMH Recombinant Antibody (5/6) (CBMAB-A2527-YC)

Go to compare Compare Online Inquiry
Published Data
Request for COA
Datasheet Target References Q & As Review & reward Protocols Associated Products

Basic Information

Host Animal
Mouse
Clone
5/6
Application
WB, IHC-P
Immunogen
Synthetic peptide derived from human AMH (VPTAYAGKLLISLSEERISAHHVPNMVATEC).
Host Species
Mouse
Specificity
Human, Monkey, Mouse, Sheep
Antibody Isotype
IgG1
Clonality
Monoclonal
Application Notes
The COA includes recommended starting dilutions, optimal dilutions should be determined by the end user.
ApplicationNote
IHC-P1:20-1:40

Formulations & Storage [For reference only, actual COA shall prevail!]

Format
Supernatant
Buffer
0.1M Tris/HCl pH7.4, 5-10% foetal calf serum.
Preservative
0.1% sodium azide
Concentration
Batch dependent
Storage
Store at 4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze/thaw cycles.
More Infomation

Target

Full Name
Anti-Mullerian Hormone
Introduction
AMH is a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expres
Entrez Gene ID
Human268
Mouse11705
Monkey717539
Sheep101121773
UniProt ID
HumanP03971
MouseP27106
MonkeyA0A0D9RH05
SheepT1SHH2
Alternative Names
Anti-Mullerian Hormone; Muellerian-Inhibiting Substance; Anti-Muellerian Hormone; MIF; MIS; Mullerian Inhibiting Substance; Muellerian-Inhibiting Factor; Mullerian Inhibiting Factor;
Function
This glycoprotein, produced by the Sertoli cells of the testis, causes regression of the Muellerian duct. It is also able to inhibit the growth of tumors derived from tissues of Muellerian duct origin.
Biological Process
Aging Source: Ensembl
BMP signaling pathway Source: Reactome
Cell-cell signaling Source: ProtInc
Gonadal mesoderm development Source: UniProtKB-KW
Mullerian duct regression Source: UniProtKB
Negative regulation of ovarian follicle development Source: Ensembl
Positive regulation of gene expression Source: UniProtKB
Positive regulation of NF-kappaB transcription factor activity Source: Ensembl
Preantral ovarian follicle growth Source: Ensembl
Response to drug Source: Ensembl
Response to organic cyclic compound Source: Ensembl
Sex determination Source: ProtInc
Sex differentiation Source: UniProtKB
Urogenital system development Source: GO_Central
Cellular Location
Secreted
Involvement in disease
Persistent Muellerian duct syndrome 1 (PMDS1): A form of male pseudohermaphroditism characterized by a failure of Muellerian duct regression in otherwise normal males.

Moolhuijsen, L. M., & Visser, J. A. (2020). Anti-Müllerian hormone and ovarian reserve: Update on assessing ovarian function. The Journal of Clinical Endocrinology & Metabolism, 105(11), 3361-3373.

Hoyos, L. R., Visser, J. A., McLuskey, A., Chazenbalk, G. D., Grogan, T. R., & Dumesic, D. A. (2020). Loss of anti-Müllerian hormone (AMH) immunoactivity due to a homozygous AMH gene variant rs10417628 in a woman with classical polycystic ovary syndrome (PCOS). Human Reproduction, 35(10), 2294-2302.

Huang, X., Xu, X., Dai, Y., Cheng, Z., Zheng, X., & Huo, X. (2020). Association of prenatal exposure to PAHs with anti-Müllerian hormone (AMH) levels and birth outcomes of newborns. Science of the Total Environment, 723, 138009.

Zhang, Z., Zhu, B., Chen, W., & Ge, W. (2020). Anti-Müllerian hormone (Amh/amh) plays dual roles in maintaining gonadal homeostasis and gametogenesis in zebrafish. Molecular and Cellular Endocrinology, 110963.

Xu, H. Y., Zhang, H. X., Xiao, Z., Qiao, J., & Li, R. (2019). Regulation of anti-Müllerian hormone (AMH) in males and the associations of serum AMH with the disorders of male fertility. Asian journal of andrology, 21(2), 109.

Yan, Y. L., Batzel, P., Titus, T., Sydes, J., Desvignes, T., BreMiller, R., ... & Postlethwait, J. H. (2019). A hormone that lost its receptor: anti-Müllerian hormone (AMH) in zebrafish gonad development and sex determination. Genetics, 213(2), 529-553.

Abbara, A., Eng, P. C., Phylactou, M., Clarke, S. A., Hunjan, T., Roberts, R., ... & Dhillo, W. S. (2019). Anti-Müllerian hormone (AMH) in the diagnosis of menstrual disturbance due to polycystic ovarian syndrome. Frontiers in endocrinology, 10, 656.

Sova, H., Unkila-Kallio, L., Tiitinen, A., Hippeläinen, M., Perheentupa, A., Tinkanen, H., ... & Morin-Papunen, L. (2019). Hormone profiling, including anti-Müllerian hormone (AMH), for the diagnosis of polycystic ovary syndrome (PCOS) and characterization of PCOS phenotypes. Gynecological Endocrinology, 35(7), 595-600.

Stracquadanio, M., Ciotta, L., & Palumbo, M. A. (2018). Relationship between serum anti-Mullerian hormone and intrafollicular AMH levels in PCOS women. Gynecological Endocrinology, 34(3), 223-228.

Kruszyńska, A., & Słowińska-Srzednicka, J. (2017). Anti-Müllerian hormone (AMH) as a good predictor of time of menopause. Przeglad menopauzalny= Menopause review, 16(2), 47.

Ask a question We look forward to hearing from you.
0 reviews or Q&As
Loading...
Have you used Mouse Anti-AMH Recombinant Antibody (5/6)?
Submit a review and get a Coupon or an Amazon gift card. 20% off Coupon $30 eGift Card
Submit a review
Loading...
For research use only. Not intended for any clinical use.

Custom Antibody Labeling

We also offer labeled antibodies developed using our catalog antibody products and nonfluorescent conjugates (HRP, AP, Biotin, etc.) or fluorescent conjugates (Alexa Fluor, FITC, TRITC, Rhodamine, Texas Red, R-PE, APC, Qdot Probes, Pacific Dyes, etc.).

Online Inquiry

Contact us

  • Tel: (USA)
  • (UK)
  • Fax:
  • Email:

Submit A Review

online inquiry
Online Inquiry