Sign in or Register
  |  

Mouse Anti-FBXO7 Monoclonal Antibody (4G8) (CBMAB-1238-YC)

Provided herein is a mouse monoclonal antibody against Human FBXO7. The antibody, clone 4G8, can be used for immunoassay techniques, such as ELISA, ICC, IF and WB.
Host Species
Mouse
Application
ELISA, ICC, IF, WB
Immunogen
Partial recombinant protein FBXO7 (NP_036311, aa 357-456) with GST tag (AVCRDLFTASNDPLLWRFLYLRDFRDNTVRVQDTDWKELYRKRHIQRKESPKGRFVMLLPSSTHTIPFYPNPLHPRPFPSSRLPPGIIGGEYDQRPTLP)
Antibody Isotype
IgG2a, κ
Specificity
Human
Clone
4G8
Format
Liquid
Storage
Store at 4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze/thaw cycles.
Introduction
The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. FBXO7 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif. FBXO7 may play a role in regulation of hematopoiesis.
Alternative Name
FBX; FBX7; PKPS; FBX07; PARK15
Entrez Gene ID
UniProt ID
Ask a question We look forward to hearing from you.
0 reviews or Q&As
Loading...
Submit a review Submit a review and you will get a coupon.
0 reviews
Loading...
For Research Use Only. Not For Clinical Use.
Cat CBMAB-1238-YC
Conjugates
Size
Price $
  ADD TO CART
Request bulk or custom quote
Second antibody and isotype control