Mouse Anti-GORASP2 Recombinant Antibody (CL2522) (CBMAB-G4387-LY)

Go to compare Compare Online Inquiry
Request for COA
Datasheet Target References Q & As Review & reward Protocols Associated Products

Basic Information

Host Animal
Mouse
Clone
CL2522
Application
WB
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PTRPFEEGKKISLPGQMAGTPITPLKDGFTEVQLSSVNPPSLSPPGTTGIEQSLTGLSISSTPPAVSSVLSTGV
Specificity
Human
Antibody Isotype
IgG1
Clonality
Monoclonal
Application Notes
The COA includes recommended starting dilutions, optimal dilutions should be determined by the end user.

Formulations & Storage [For reference only, actual COA shall prevail!]

Format
Liquid
Purity
> 95% Purity determined by SDS-PAGE.
Storage
Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freezethaw cycles.
More Infomation

Target

Full Name
golgi reassembly stacking protein 2
Introduction
This gene encodes a member of the Golgi reassembly stacking protein family. These proteins may play a role in the stacking of Golgi cisternae and Golgi ribbon formation, as well as Golgi fragmentation during apoptosis or mitosis. The encoded protein also plays a role in the intracellular transport of transforming growth factor alpha and may function as a molecular chaperone. A pseudogene of this gene is located on the short arm of chromosome 2. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jan 2011]
Entrez Gene ID
UniProt ID
Alternative Names
Golgi Reassembly Stacking Protein 2; Golgi Reassembly Stacking Protein 2; 55kDa; Golgi Phosphoprotein 6; GRASP55; GOLPH6; GRS2;
Function
Plays a role in the assembly and membrane stacking of the Golgi cisternae, and in the process by which Golgi stacks reform after breakdown during mitosis and meiosis (PubMed:10487747, PubMed:21515684, PubMed:22523075).

May regulate the intracellular transport and presentation of a defined set of transmembrane proteins, such as transmembrane TGFA (PubMed:11101516).

Required for normal acrosome formation during spermiogenesis and normal male fertility, probably by promoting colocalization of JAM2 and JAM3 at contact sites between germ cells and Sertoli cells (By similarity).

Mediates ER stress-induced unconventional (ER/Golgi-independent) trafficking of core-glycosylated CFTR to cell membrane (PubMed:21884936, PubMed:27062250, PubMed:28067262).
Biological Process
Cell differentiation Source: UniProtKB-KW
Establishment of protein localization to plasma membrane Source: UniProtKB
Golgi organization Source: GO_Central
Organelle assembly Source: UniProtKB
Organelle organization Source: UniProtKB
Response to endoplasmic reticulum stress Source: UniProtKB
Spermatogenesis Source: UniProtKB-KW
Cellular Location
Endoplasmic reticulum membrane; Golgi apparatus membrane; Golgi apparatus. Detected in the intermediate Golgi, membrane-associated (By similarity). ER stress triggers its relocalization from Golgi to ER membrane (PubMed:27062250, PubMed:28067262).
PTM
Myristoylated (PubMed:11101516). Myristoylation is essential for the Golgi targeting (By similarity).
Palmitoylated.
Phosphorylated in mitotic cells (PubMed:11408587). ER stress-induced phosphorylation at Ser-441 induces monomerization and subsequent relocalization from Golgi to ER which is essential for mediating unconventional (ER/Golgi-independent) trafficking of CFTR to the cell membrane (PubMed:21884936, PubMed:27062250).
Ask a question We look forward to hearing from you.
0 reviews or Q&As
Loading...
Have you used Mouse Anti-GORASP2 Recombinant Antibody (CL2522)?
Submit a review and get a Coupon or an Amazon gift card. 20% off Coupon $30 eGift Card
Submit a review
Loading...
For research use only. Not intended for any clinical use.

Custom Antibody Labeling

We also offer labeled antibodies developed using our catalog antibody products and nonfluorescent conjugates (HRP, AP, Biotin, etc.) or fluorescent conjugates (Alexa Fluor, FITC, TRITC, Rhodamine, Texas Red, R-PE, APC, Qdot Probes, Pacific Dyes, etc.).

Online Inquiry

Contact us

  • Tel: (USA)
  • (UK)
  • Fax:
  • Email:

Submit A Review

online inquiry
Online Inquiry
Happy Holidays
Happy Holidays close ad