Mouse Anti-CASP2 Recombinant Antibody (CBFYC-0833) (CBMAB-C0888-FY)

Go to compare Compare Online Inquiry
Request for COA
Datasheet Target References Q & As Review & reward Protocols Associated Products

Basic Information

Host Animal
Mouse
Clone
CBFYC-0833
Application
ELISA, IF, WB
Immunogen
TLSGLQHVLPPLSCDYDLSLPFPVCESCPLYKKLRLSTDT VEHSLDNKDGPLCLQVKPCTPEFYQTHFQLAYRLQSRPRG LALVLSNVHFTGEKELEFRS
Host Species
Mouse
Specificity
Human
Antibody Isotype
IgG2a, κ
Clonality
Monoclonal
Application Notes
The COA includes recommended starting dilutions, optimal dilutions should be determined by the end user.

Formulations & Storage [For reference only, actual COA shall prevail!]

Format
Liquid
Buffer
PBS, pH 7.2
Preservative
None
Concentration
Batch dependent
Storage
Store at +4°C short term (1-2 weeks). Aliquot and store at-20°C long term. Avoid repeated freeze/thaw cycles.
Epitope
AA 400-412
More Infomation

Target

Full Name
Caspase 2
Introduction
This gene encodes a member of the cysteine-aspartic acid protease (caspase) family. Caspases mediate cellular apoptosis through the proteolytic cleavage of specific protein substrates. The encoded protein may function in stress-induced cell death pathways, cell cycle maintenance, and the suppression of tumorigenesis. Increased expression of this gene may play a role in neurodegenerative disorders including Alzheimer's disease, Huntington's disease and temporal lobe epilepsy. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Entrez Gene ID
UniProt ID
Alternative Names
Caspase 2; Neural Precursor Cell Expressed Developmentally Down-Regulated Protein 2; Protein Phosphatase 1, Regulatory Subunit 57; Protease ICH-1; EC 3.4.22.55; CASP-2; NEDD-2; NEDD2
Function
Involved in the activation cascade of caspases responsible for apoptosis execution. Might function by either activating some proteins required for cell death or inactivating proteins necessary for cell survival (PubMed:15073321).
Associates with PIDD1 and CRADD to form the PIDDosome, a complex that activates CASP2 and triggers apoptosis in response to genotoxic stress (PubMed:15073321).
Biological Process
Activation of cysteine-type endopeptidase activity involved in apoptotic process Source: GO_Central
Aging Source: Ensembl
Apoptotic process Source: GO_Central
Apoptotic signaling pathway Source: UniProtKB
Brain development Source: Ensembl
Cellular response to mechanical stimulus Source: UniProtKB
DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest Source: UniProtKB
Ectopic germ cell programmed cell death Source: Ensembl
Execution phase of apoptosis Source: UniProtKB
Extrinsic apoptotic signaling pathway in absence of ligand Source: GO_Central
Intrinsic apoptotic signaling pathway in response to DNA damage Source: GO_Central
Luteolysis Source: Ensembl
Negative regulation of apoptotic process Source: UniProtKB
Neural retina development Source: Ensembl
Positive regulation of apoptotic process Source: UniProtKB
Positive regulation of apoptotic signaling pathway Source: Ensembl
Positive regulation of neuron apoptotic process Source: Ensembl
Protein processing Source: BHF-UCL
Regulation of apoptotic process Source: Reactome
Cellular Location
Cytosol; Mitochondrion; Nucleus; Cytoplasm; Membrane
PTM
The mature protease can process its own propeptide, but not that of other caspases.

Kopeina, G. S., & Zhivotovsky, B. (2021). Caspase-2 as a master regulator of genomic stability. Trends in Cell Biology.

Lim, Y., Dorstyn, L., & Kumar, S. (2021). The p53-caspase-2 axis in the cell cycle and DNA damage response. Experimental & Molecular Medicine, 53(4), 517-527.

Ochiai, A., Sawaguchi, S., Memezawa, S., Seki, Y., Morimoto, T., Oizumi, H., ... & Yamauchi, J. (2021). Knockdown of Golgi Stress-Responsive Caspase-2 Ameliorates HLD17-Associated AIMP2 Mutant-Mediated Inhibition of Oligodendroglial Cell Morphological Differentiation. Neurochemical Research, 1-15.

Yang, L., Dou, Y., Sui, Z., Cheng, H., Liu, X., Wang, Q., ... & Xu, M. (2020). Upregulated miRNA‑182‑5p expression in tumor tissue and peripheral blood samples from patients with non‑small cell lung cancer is associated with downregulated Caspase 2 expression. Experimental and therapeutic medicine, 19(1), 603-610.

Petroni, G., Vitale, I., & Galluzzi, L. (2020). Caspase 2 and p53 Reunited in Tumor Control. Trends in Cell Biology, 30(12), 917-918.

Smith, B. R., Nelson, K. M., Kemper, L. J., Leinonen-Wright, K., Petersen, A., Keene, C. D., & Ashe, K. H. (2019). A soluble tau fragment generated by caspase-2 is associated with dementia in Lewy body disease. Acta neuropathologica communications, 7(1), 1-9.

Vigneswara, V., & Ahmed, Z. (2019). Pigment epithelium-derived factor mediates retinal ganglion cell neuroprotection by suppression of caspase-2. Cell death & disease, 10(2), 1-17.

Liu, P., Smith, B. R., Huang, E. S., Mahesh, A., Vonsattel, J. P. G., Petersen, A. J., ... & Ashe, K. H. (2019). A soluble truncated tau species related to cognitive dysfunction and caspase-2 is elevated in the brain of Huntington’s disease patients. Acta neuropathologica communications, 7(1), 1-13.

Vitale, I., Manic, G., Castedo, M., & Kroemer, G. (2017). Caspase 2 in mitotic catastrophe: The terminator of aneuploid and tetraploid cells. Molecular & cellular oncology, 4(3), e1299274.

Forsberg, J., Zhivotovsky, B., & Olsson, M. (2017). Caspase-2: an orphan enzyme out of the shadows. Oncogene, 36(39), 5441-5444.

Ask a question We look forward to hearing from you.
0 reviews or Q&As
Loading...
Have you used Mouse Anti-CASP2 Recombinant Antibody (CBFYC-0833)?
Submit a review and get a Coupon or an Amazon gift card. 20% off Coupon $30 eGift Card
Submit a review
Loading...
For research use only. Not intended for any clinical use.

Custom Antibody Labeling

We also offer labeled antibodies developed using our catalog antibody products and nonfluorescent conjugates (HRP, AP, Biotin, etc.) or fluorescent conjugates (Alexa Fluor, FITC, TRITC, Rhodamine, Texas Red, R-PE, APC, Qdot Probes, Pacific Dyes, etc.).

Online Inquiry

Contact us

  • Tel: (USA)
  • (UK)
  • Fax:
  • Email:

Submit A Review

online inquiry
Online Inquiry
Happy Holidays
Happy Holidays close ad