Mouse Anti-CD1B Recombinant Antibody (CBXC-1308) (CBMAB-C1575-CQ)

Go to compare Compare Online Inquiry
Request for COA
Datasheet Target References Q & As Review & reward Protocols Associated Products

Basic Information

Host Animal
Mouse
Clone
CBXC-1308
Application
ELISA
Immunogen
EHAFQGPTSFHVIQTSSFTNSTWAQTQGSGWLDDLQIHGW DSDSGTAIFLKPWSKGNFSDKEVAELEEIFRVYIFGFARE VQDFAGDFQMKY
Host Species
Mouse
Specificity
Human
Antibody Isotype
IgG2a, κ
Clonality
Monoclonal Antibody
Application Notes
The COA includes recommended starting dilutions, optimal dilutions should be determined by the end user.

Formulations & Storage [For reference only, actual COA shall prevail!]

Format
Liquid
Buffer
PBS
Preservative
None
Concentration
Batch dependent
Storage
Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze/thaw cycles.
More Infomation

Target

Full Name
CD1b Molecule
Introduction
CD1B (CD1b Molecule) is a Protein Coding gene. Diseases associated with CD1B include Mycobacterium Malmoense and Mycobacterium Tuberculosis 1. Among its related pathways are Innate Immune System and Class I MHC mediated antigen processing and presentation. Gene Ontology (GO) annotations related to this gene include beta-2-microglobulin binding and endogenous lipid antigen binding. An important paralog of this gene is CD1A.
Entrez Gene ID
UniProt ID
Function
Antigen-presenting protein that binds self and non-self lipid and glycolipid antigens and presents them to T-cell receptors on natural killer T-cells.
Biological Process
Adaptive immune response Source: UniProtKB-KW
Antigen processing and presentation, endogenous lipid antigen via MHC class Ib Source: GO_Central
Antigen processing and presentation, exogenous lipid antigen via MHC class Ib Source: GO_Central
Positive regulation of T cell mediated cytotoxicity Source: GO_Central
Regulation of immune response Source: Reactome
Cellular Location
Lysosome membrane; Endosome membrane; Cell membrane. Subject to intracellular trafficking between the cell membrane, endosomes and lysosomes.
Topology
Extracellular: 18-303
Helical: 304-324
Cytoplasmic: 325-333

Ween, M. P., White, J. B., Tran, H. B., Mukaro, V., Jones, C., Macowan, M., ... & Hodge, S. J. (2021). The role of oxidised self-lipids and alveolar macrophage CD1b expression in COPD. Scientific reports, 11(1), 1-14.

Guo, J., Jin, H., Xi, Y., Guo, J., Jin, Y., & Jiang, D. (2020). The miR-582/CD1B axis is involved in regulation of dendritic cells and is associated with clinical outcomes in advanced lung adenocarcinoma. BioMed research international, 2020.

Reijneveld, J. F., Ocampo, T. A., Shahine, A., Gully, B. S., Vantourout, P., Hayday, A. C., ... & Van Rhijn, I. (2020). Human γδ T cells recognize CD1b by two distinct mechanisms. Proceedings of the National Academy of Sciences, 117(37), 22944-22952.

Camacho, F., Moreno, E., Garcia-Alles, L., Santiago, G. C., Gilleron, M., Vasquez, A., ... & Acosta, A. (2020). A direct role for the CD1b endogenous spacer in the recognition of a Mycobacterium tuberculosis antigen by T-cell receptors. Frontiers in immunology, 11, 2538.

Shahine, A., Reinink, P., Reijneveld, J. F., Gras, S., Holzheimer, M., Cheng, T. Y., ... & Van Rhijn, I. (2019). A T-cell receptor escape channel allows broad T-cell response to CD1b and membrane phospholipids. Nature communications, 10(1), 1-12.

Lee, C. H., Chen, L. C., Yu, C. C., Lin, W. H., Lin, V. C., Huang, C. Y., ... & Bao, B. Y. (2019). Prognostic value of CD1B in localised prostate cancer. International journal of environmental research and public health, 16(23), 4723.

Shahine, A. (2018). The intricacies of self-lipid antigen presentation by CD1b. Molecular immunology, 104, 27-36.

Chancellor, A., Tocheva, A. S., Cave-Ayland, C., Tezera, L., White, A., Juma’a, R., ... & Mansour, S. (2017). CD1b-restricted GEM T cell responses are modulated by Mycobacterium tuberculosis mycolic acid meromycolate chains. Proceedings of the National Academy of Sciences, 114(51), E10956-E10964.

Ask a question We look forward to hearing from you.
0 reviews or Q&As
Loading...
Have you used Mouse Anti-CD1B Recombinant Antibody (CBXC-1308)?
Submit a review and get a Coupon or an Amazon gift card. 20% off Coupon $30 eGift Card
Submit a review
Loading...
For research use only. Not intended for any clinical use.

Custom Antibody Labeling

We also offer labeled antibodies developed using our catalog antibody products and nonfluorescent conjugates (HRP, AP, Biotin, etc.) or fluorescent conjugates (Alexa Fluor, FITC, TRITC, Rhodamine, Texas Red, R-PE, APC, Qdot Probes, Pacific Dyes, etc.).

Online Inquiry

Contact us

  • Tel: (USA)
  • (UK)
  • Fax:
  • Email:

Submit A Review

online inquiry
Online Inquiry
Happy Holidays
Happy Holidays close ad